Structure of PDB 8yte Chain A Binding Site BS01

Receptor Information
>8yte Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSFPASVQLHTAVEMHHWCIPFSVDGQPAPSLRWLFNGSVLNETSFIFTE
FLEPAANETVRHGCLRLNQPTHVNNGNYTLLAANPFGQASASIMAAFM
Ligand information
>8yte Chain B (length=14) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GFFLYPHGFYGIVC
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yte Discovery and Hit to Lead Optimization of Macrocyclic Peptides as Novel Tropomyosin Receptor Kinase A Antagonists.
Resolution2.26 Å
Binding residue
(original residue number in PDB)		A310 P311 S312 L313 E324 T325 S326 F329 T330 F332 E334
Binding residue
(residue number reindexed from 1)		A29 P30 S31 L32 E43 T44 S45 F48 T49 F51 E53
External links
PDB RCSB:8yte, PDBe:8yte, PDBj:8yte
PDBsum8yte
PubMed38950284
UniProtP04629|NTRK1_HUMAN High affinity nerve growth factor receptor (Gene Name=NTRK1)

[Back to BioLiP]