Structure of PDB 8ym2 Chain A Binding Site BS01

Receptor Information
>8ym2 Chain A (length=149) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKEGTESTQDACAKMRAN
CQKSQMKKVPTIILSVSYKGVKFIDAANKNIIAEHEIRNISCAAQDPEDL
STFAYITKDSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ym2 AIDA-1/ANKS1B binds to the SynGAP family GTPases with high affinity and specificity
Resolution2.0 Å
Binding residue
(original residue number in PDB)
T1035 A1036 S1037 T1038 I1125 I1128 S1129 C1130 A1131 A1132 Q1133 I1170 L1171 F1177 A1180 Y1181
Binding residue
(residue number reindexed from 1)
T1 A2 S3 T4 I87 I90 S91 C92 A93 A94 Q95 I130 L131 F137 A140 Y141
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8ym2, PDBe:8ym2, PDBj:8ym2
PDBsum8ym2
PubMed38759928
UniProtQ8BIZ1|ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B (Gene Name=Anks1b)

[Back to BioLiP]