Structure of PDB 8yfi Chain A Binding Site BS01

Receptor Information
>8yfi Chain A (length=142) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SWCLSVHQPWASLLVRGIKRVEGRSWYTPHRGRLWIAATAKKPSPQEVSE
LQATYRLLRGKDVEFPNDYPSGCLLGCVDLIDCLSQKQFKEQFPDISQES
DSPFVFICKNPQEMVVKFPIKGNPKIWKLDSKIHQGAKKGLM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8yfi Biochemical and structural characterization of the DNA-binding properties of human TRIP4 ASCH domain reveals insights into its functional role.
Resolution2.02 Å
Binding residue
(original residue number in PDB)		T472 A473 K554 G555 N556 P557
Binding residue
(residue number reindexed from 1)		T39 A40 K121 G122 N123 P124
External links
PDB RCSB:8yfi, PDBe:8yfi, PDBj:8yfi
PDBsum8yfi
PubMed38870938
UniProtQ15650|TRIP4_HUMAN Activating signal cointegrator 1 (Gene Name=TRIP4)

[Back to BioLiP]