Structure of PDB 8xke Chain A Binding Site BS01

Receptor Information
>8xke Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAP
WIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYG
CDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAV
HAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRW
Ligand information
>8xke Chain M (length=12) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EVDNATRFASVY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xke Uncommon P1 Anchor-featured Viral T Cell Epitope Preference within HLA-A*2601 and HLA-A*0101 Individuals.
Resolution1.92 Å
Binding residue
(original residue number in PDB)		Y7 E63 T73 N77 L81 Y84 Y99 D116 T143 K146 W147 A152 Q155 R156 Y159 R163 R170 Y171
Binding residue
(residue number reindexed from 1)		Y7 E63 T73 N77 L81 Y84 Y99 D116 T143 K146 W147 A152 Q155 R156 Y159 R163 R170 Y171
External links