Structure of PDB 8xg2 Chain A Binding Site BS01

Receptor Information
>8xg2 Chain A (length=274) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAP
WIEQEGPEYWDRNTRNVKAHSQTDRANLGTLRGYYNQSEDGSHTIQRMYG
CDVGPDGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETA
HEAEQWRAYLEGRCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEAT
LRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVP
SGQEQRYTCHVQHEGLPKPLTLRW
Ligand information
>8xg2 Chain C (length=12) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EVFNATRFASVY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xg2 Uncommon P1 Anchor-featured Viral T Cell Epitope Preference within HLA-A*2601 and HLA-A*0101 Individuals.
Resolution1.84 Å
Binding residue
(original residue number in PDB)		Y7 Y59 R62 N63 H70 T73 N77 L81 Y84 Y99 D116 T143 K146 W147 E152 Q155 W156 Y159 R163 W167 Y171
Binding residue
(residue number reindexed from 1)		Y7 Y59 R62 N63 H70 T73 N77 L81 Y84 Y99 D116 T143 K146 W147 E152 Q155 W156 Y159 R163 W167 Y171
External links