Structure of PDB 8xas Chain A Binding Site BS01

Receptor Information
>8xas Chain A (length=59) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPRVVWSVELHQQFVAAVNQLGVEKAVPKKILELMNVPGLTRENVASHLQ
KYRIYLRRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8xas The structure of B-ARR reveals the molecular basis of transcriptional activation by cytokinin.
Resolution2.346 Å
Binding residue
(original residue number in PDB)		V43 P44 K45 Q66 R69
Binding residue
(residue number reindexed from 1)		V27 P28 K29 Q50 R53
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8xas, PDBe:8xas, PDBj:8xas
PDBsum8xas
PubMed38198526
UniProtQ940D0|ARR1_ARATH Two-component response regulator ARR1 (Gene Name=ARR1)

[Back to BioLiP]