Structure of PDB 8x8a Chain A Binding Site BS01

Receptor Information
>8x8a Chain A (length=117) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKFQYKEDHPFEYRKKEGEKIRKKYPDRVPVIVEKAPKARVPDLDKRKYL
VPSDLTVGQFYFLIRKRIHLRPEDALFFFVNNTIPPTSATMGQLYEDNHE
EDYFLYVAYSDESVYGK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8x8a Decoding the molecular mechanism of selective autophagy of glycogen mediated by autophagy receptor STBD1.
Resolution1.53 Å
Binding residue
(original residue number in PDB)		D27 R28 P30 K46 K48 Y49 L50 P52 Q59 F62 R67 F104
Binding residue
(residue number reindexed from 1)		D27 R28 P30 K46 K48 Y49 L50 P52 Q59 F62 R67 F104
External links
PDB RCSB:8x8a, PDBe:8x8a, PDBj:8x8a
PDBsum8x8a
PubMed39236246
UniProtQ9H0R8|GBRL1_HUMAN Gamma-aminobutyric acid receptor-associated protein-like 1 (Gene Name=GABARAPL1)

[Back to BioLiP]