Structure of PDB 8wzc Chain A Binding Site BS01

Receptor Information

>8wzc Chain A (length=163) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SNADLRHIVIDGSNVAMVHGLQHYFSSRGIAIAVQYFWDRGHRDITVFVP
QWAFSKDAKVRESHFLQKLYSLSLLSLTPSRVMDGKRISSYDDRFMVKLA
EETDGIIVSNDQFRDLAEESEKWMAIIRERLLPFTFVGNLFMVPDDPLGR
NGPTLDEFLKKPA

Ligand information

>8wzc Chain D (length=5) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

uuuau

.....

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8wzc Crystal structure of NYN domain of Human KHNYN in complex with single strand RNA.
Resolution	1.925 Å
Binding residue (original residue number in PDB)	S486 N487 M490 Q495 W525 R560 Y564 D566 N583 D584 Q585
Binding residue (residue number reindexed from 1)	S13 N14 M17 Q22 W52 R87 Y91 D93 N110 D111 Q112

External links

PDB	RCSB:8wzc, PDBe:8wzc, PDBj:8wzc
PDBsum	8wzc
PubMed	39167961
UniProt	O15037\|KHNYN_HUMAN Protein KHNYN (Gene Name=KHNYN)

[Back to BioLiP]