Structure of PDB 8wms Chain A Binding Site BS01

Receptor Information
>8wms Chain A (length=66) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPSCKHCKDDVNRLCRVCACHLCGGRQDPDKQLMCDECDMAFHIYCLDPP
LSSVPSEDEWYCPECR
Ligand information
>8wms Chain B (length=24) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GVRTLLSVQREKMARLRYMLLGGV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wms Crystal structure of human DPPA3 in complex with human UHRF1 PHD domain
Resolution2.4 Å
Binding residue
(original residue number in PDB)		P327 D328 Q330 L331 M332 D334 D337 E355 D356
Binding residue
(residue number reindexed from 1)		P29 D30 Q32 L33 M34 D36 D39 E57 D58
External links
PDB RCSB:8wms, PDBe:8wms, PDBj:8wms
PDBsum8wms
PubMed
UniProtQ96T88|UHRF1_HUMAN E3 ubiquitin-protein ligase UHRF1 (Gene Name=UHRF1)

[Back to BioLiP]