Structure of PDB 8wh9 Chain A Binding Site BS01

Receptor Information
>8wh9 Chain A (length=93) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
FRPGTVALREIRKYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVA
ALQEAAEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGE
Ligand information
>8wh9 Chain I (length=142) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
agaatcccggtgccgaggccgctcaattggtcgtagacagctctagcacc
gcttaaacgcacgtacgcgctgtcccccgcgtttaaccgcccaaggggat
tactccctagtctccaggcacgtgtcagatatatacatccga
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8wh9 Molecular basis of chromatin remodelling by DDM1 involved in plant DNA methylation.
Resolution3.31 Å
Binding residue
(original residue number in PDB)		F41 V46 K64 P66 R69 R83
Binding residue
(residue number reindexed from 1)		F1 V6 K24 P26 R29 R43
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009536 plastid
GO:0010369 chromocenter

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8wh9, PDBe:8wh9, PDBj:8wh9
PDBsum8wh9
PubMed38413824
UniProtP59226|H31_ARATH Histone H3.1 (Gene Name=HTR2)

[Back to BioLiP]