Structure of PDB 8vy8 Chain A Binding Site BS01

Receptor Information
>8vy8 Chain A (length=75) Species: 8616 (Bungarus multicinctus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GIVCHTTATSPISAVTCPPGENLCYRKMWCDVFCSSRGKVVELGCAATCP
SKKPYEEVTCCSTDKCNPHPKQRPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vy8 Structure of recombinant alpha bungarotoxin complexed with HAP peptide at 2.4 Angstroms resolution.
Resolution2.4 Å
Binding residue
(original residue number in PDB)
T6 A7 T8 S9 I11 M27 D30 R36 G37 K38 V39 V40 H68 K70
Binding residue
(residue number reindexed from 1)
T7 A8 T9 S10 I12 M28 D31 R37 G38 K39 V40 V41 H69 K71
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:8vy8, PDBe:8vy8, PDBj:8vy8
PDBsum8vy8
PubMed38347541
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]