Structure of PDB 8vng Chain A Binding Site BS01

Receptor Information

>8vng Chain A (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV

Ligand information

>8vng Chain C (length=21) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ttgactctcttaagagagtca

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8vng Homing endonuclease I-PpoI-DNA complex:reaction with 500 uM Mg2+ for 160s
Resolution	1.6 Å
Binding residue (original residue number in PDB)	A48 P49 G53 K56 N57 K65 T67
Binding residue (residue number reindexed from 1)	A47 P48 G52 K55 N56 K64 T66

Gene Ontology

	Molecular Function
GO:0004519	endonuclease activity

	Biological Process
GO:0006314	intron homing

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:8vng, PDBe:8vng, PDBj:8vng
PDBsum	8vng
PubMed
UniProt	Q94702\|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]