Structure of PDB 8vnd Chain A Binding Site BS01

Receptor Information
>8vnd Chain A (length=162) Species: 5791 (Physarum polycephalum) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTNAQILAVIDSWEETVGQFPVITHHVPLGGGLQGTLHCYEIPLAAPYG
VGFAKNGPTRWQYKRTINQVVHRWGSHTVPFLLEPDNINGKTCTASHLCH
NTRCHNPLHLCWESLDDNKGRNWCPGPNGGCVHAVVCLRQGPLYGPGATV
AGPQQRGSHFVV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vnd Homing endonuclease I-PpoI-DNA complex:reaction with 500 uM Mg2+ for 160s
Resolution1.6 Å
Binding residue
(original residue number in PDB)		A48 P49 G53 A55 K56 N57 K65 T67
Binding residue
(residue number reindexed from 1)		A47 P48 G52 A54 K55 N56 K64 T66
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
Biological Process
GO:0006314 intron homing

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8vnd, PDBe:8vnd, PDBj:8vnd
PDBsum8vnd
PubMed
UniProtQ94702|PPO1_PHYPO Intron-encoded endonuclease I-PpoI

[Back to BioLiP]