Structure of PDB 8vgc Chain A Binding Site BS01

Receptor Information
>8vgc Chain A (length=75) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTV
DYETLMKVMDTLHQAGYLKIGLVGE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vgc Discovery and structural characterization of the D-box, a conserved TonB motif that couples an inner-membrane motor to outer-membrane transport.
Resolution1.42 Å
Binding residue
(original residue number in PDB)
M119 I130 G131 L132 G134
Binding residue
(residue number reindexed from 1)
M59 I70 G71 L72 G74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0022857 transmembrane transporter activity
Biological Process
GO:0055085 transmembrane transport

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:8vgc, PDBe:8vgc, PDBj:8vgc
PDBsum8vgc
PubMed38311172
UniProtP0ABV2|EXBD_ECOLI Biopolymer transport protein ExbD (Gene Name=exbD)

[Back to BioLiP]