Structure of PDB 8vdu Chain A Binding Site BS01

Receptor Information
>8vdu Chain A (length=183) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLF
RRFRRFDPQFALTNIAVLKHNLNCVIKRSNSTAATNEVPEVTVFSKSPVT
LGQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKI
SYLTFLPSADEIYDCKVEHWGLDEPLLKHWEPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vdu A structural basis of T cell cross-reactivity to a native and spliced self-antigens presented by HLA-DQ8
Resolution3.5 Å
Binding residue
(original residue number in PDB)		H24 R52 R53 F54 F58 N62 V65 H68 N69 C72 R76
Binding residue
(residue number reindexed from 1)		H26 R54 R55 F56 F60 N64 V67 H70 N71 C74 R78
External links