Structure of PDB 8vcx Chain A Binding Site BS01

Receptor Information
>8vcx Chain A (length=181) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVADHVASYGVNLYQSYGPSGQYSHEFDGDEEFYVDLERKETVWQLPLFR
RFRRFDPQFALTNIAVLKHNLNCVIKRSNSTAATNEVPEVTVFSKSPVTL
GQPNTLICLVDNIFPPVVNITWLSNGHSVTEGVSETSFLSKSDHSFFKIS
YLTFLPSADEIYDCKVEHWGLDEPLLKHWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8vcx A structural basis of T cell cross-reactivity to a native and spliced self-antigens presented by HLA-DQ8
Resolution2.59 Å
Binding residue
(original residue number in PDB)		Y9 R52 R53 F54 F58 N62 H68 N69 C72 R76
Binding residue
(residue number reindexed from 1)		Y9 R53 R54 F55 F59 N63 H69 N70 C73 R77
External links