Structure of PDB 8uzt Chain A Binding Site BS01

Receptor Information

>8uzt Chain A (length=102) Species: 9606 (Homo sapiens)

LERSLNRVHLLGRVGQDPVLRQVEGKNPVTIFSLATNEMQKTTWHRISVF
RPGLRDVAYQYVKKGSRIYLEGKIDYGEYMDKNNVRRQATTIIADNIIFL
SD

Ligand information

>8uzt Chain G (length=17)

ttttttttttttttttt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 8uzt Structures of the mitochondrial single-stranded DNA binding protein with DNA and DNA polymerase gamma.
• Resolution: 1.9 Å
• Binding residue (original residue number in PDB): R38 V39 G40 S58 A60 N62 M64 Q80 W84 K104
• Binding residue (residue number reindexed from 1): R13 V14 G15 S33 A35 N37 M39 Q40 W44 K64

External links

• PDB: RCSB:8uzt, PDBe:8uzt, PDBj:8uzt
• PDBsum: 8uzt
• PubMed: 39106165
• UniProt: Q04837|SSBP_HUMAN Single-stranded DNA-binding protein, mitochondrial (Gene Name=SSBP1)