Structure of PDB 8ux1 Chain A Binding Site BS01

Receptor Information
>8ux1 Chain A (length=98) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQS
SAVMALQEASEAYLVGLFEDTNLSAIHAKRVTIMPKDIQLARRIRGER
Ligand information
>8ux1 Chain I (length=145) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
aggatgtatatatctgacacgtgcctggagactagggagtaatccccttg
gcggttaaaacgcgggggacagcgcgtacgtgcgtttaagcggtgctaga
gctgtctacgaccaattgagcggcctcggcaccgggattctccag
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ux1 Cryo-EM structure of Ran bound to RCC1 and the nucleosome core particle
Resolution2.5 Å
Binding residue
(original residue number in PDB)		K37 R40 R42 T45 R72 R83 F84 S86 R116 T118
Binding residue
(residue number reindexed from 1)		K1 R4 R6 T9 R36 R47 F48 S50 R80 T82
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
Cellular Component
GO:0000785 chromatin
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005700 polytene chromosome
GO:0035059 RCAF complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ux1, PDBe:8ux1, PDBj:8ux1
PDBsum8ux1
PubMed
UniProtP02299|H3_DROME Histone H3 (Gene Name=His3)

[Back to BioLiP]