Structure of PDB 8utl Chain A Binding Site BS01

Receptor Information

>8utl Chain A (length=223) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRL
GEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRV
ASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKS
AYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQK
NKPGVYTKVCNYVSWIKQTIASN

Ligand information

>8utl Chain C (length=12) Species: 507735 (Microcystis aeruginosa MRC) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ISARKYPSDWEE

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8utl Alternative Linkage Chemistries in the Chemoenzymatic Synthesis of Microviridin-Based Cyclic Peptides.
Resolution	1.56 Å
Binding residue (original residue number in PDB)	F41 C42 H57 Y151 D189 S190 C191 Q192 G193 S195 S214 W215 G216
Binding residue (residue number reindexed from 1)	F24 C25 H40 Y131 D171 S172 C173 Q174 G175 S177 S192 W193 G194

Enzymatic activity

Enzyme Commision number

3.4.21.4: trypsin.

Gene Ontology

	Molecular Function
GO:0004175	endopeptidase activity
GO:0004252	serine-type endopeptidase activity
GO:0005515	protein binding
GO:0008236	serine-type peptidase activity
GO:0046872	metal ion binding
GO:0097655	serpin family protein binding

	Biological Process
GO:0006508	proteolysis
GO:0007586	digestion

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0097180	serine protease inhibitor complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8utl, PDBe:8utl, PDBj:8utl
PDBsum	8utl
PubMed	38306609
UniProt	P00760\|TRY1_BOVIN Serine protease 1 (Gene Name=PRSS1)

[Back to BioLiP]