Structure of PDB 8urq Chain A Binding Site BS01

Receptor Information
>8urq Chain A (length=358) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALEGLRKKYKTRQELVKALTPKRRSIHLNSCSNADVLAHIKHFLSLAANS
LEQHQQPISIVFQNKKKHTTLDFPLNGPHLSTHQFKLKRCAILLNLLKVV
MEKLPLGKNTTVRDIFYSNVELFQRQANVVQWLDVIRFNFKLSPRKSLNI
IPAQKGLVYSPFPIDIYDNIQKQTIFSGKPCLIPFFQDDAVIKLGNIVIV
EKEAVFTKLVNNYHNTMLITGKGFPDFLTRLFLKKLEQYCSNLISDCSIF
TDADPYGISIALNYTHSNERNAYICTMANYKGIRITQVLAQNNESIQLLS
LNQRDYSLAKNLIASLTANSWDIATSPLKNVVIECQREIFFQKKAEMNEI
DAGIFKYK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8urq Cryo-EM structure of the yeast Spo11 core complex bound to DNA
Resolution3.3 Å
Binding residue
(original residue number in PDB)		K76 H101 R131 Q144 K173 E233 G259 F260 D262 F263 R266 R344 S347
Binding residue
(residue number reindexed from 1)		K67 H83 R113 Q126 K155 E201 G223 F224 D226 F227 R230 R304 S307
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003682 chromatin binding
GO:0003916 DNA topoisomerase activity
GO:0003918 DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity
GO:0005515 protein binding
GO:0045027 DNA end binding
GO:0046872 metal ion binding
Biological Process
GO:0000706 meiotic DNA double-strand break processing
GO:0007127 meiosis I
GO:0007129 homologous chromosome pairing at meiosis
GO:0007130 synaptonemal complex assembly
GO:0007131 reciprocal meiotic recombination
GO:0019953 sexual reproduction
GO:0030435 sporulation resulting in formation of a cellular spore
GO:0042138 meiotic DNA double-strand break formation
GO:0051321 meiotic cell cycle
Cellular Component
GO:0000228 nuclear chromosome
GO:0000794 condensed nuclear chromosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome
GO:0035861 site of double-strand break

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8urq, PDBe:8urq, PDBj:8urq
PDBsum8urq
PubMed
UniProtP23179|SPO11_YEAST Meiosis-specific protein SPO11 (Gene Name=SPO11)

[Back to BioLiP]