Structure of PDB 8urk Chain A Binding Site BS01

Receptor Information
>8urk Chain A (length=249) Species: 95486 (Burkholderia cenocepacia) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPSGIELHNRDFLTDAAHLPDASIDLIVADPPYGLGKDYGNDSDKRSGDD
FLAWTREWLELAIPKLKPSGSMYIFCTWQYAPEIFSFLKTQLTMVNEIIW
DRRVPSMGGTTRRFTSVHDNIGFFAVSRAYYFDLDPVRIPYDADTKKARS
RKLFEGSKWLEMGYNPKDVWSVSRLHRQHAERVDHPTQKPLEIIERMVLA
SCPPGGRVLDPFMGSGTTAVACARQGRDFVGYEINESYCAIAHERVNAL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8urk Burkholderia cenocepacia epigenetic regulator M.BceJIV simultaneously engages two DNA recognition sequences for methylation.
Resolution2.11 Å
Binding residue
(original residue number in PDB)		P60 P61 Y62 L64 K66 Y68 D73 T106 W107 V133 S135 M136 G137 T139 R141 R142 S145 D148 R203 H205 R206 R211 T216 K218
Binding residue
(residue number reindexed from 1)		P31 P32 Y33 L35 K37 Y39 D44 T77 W78 V104 S106 M107 G108 T110 R112 R113 S116 D119 R174 H176 R177 R182 T187 K189
External links