Structure of PDB 8uk9 Chain A Binding Site BS01

Receptor Information
>8uk9 Chain A (length=182) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLFKDDIQLNEHQVAWYSKDWTAVQSAADSFKEKAENEFFEIIGAINNKT
KCSIAQKDYSKFMVENALSQFPECMPAVYAMNLIGSGLSDEAHFNYLMAA
VPRGKRYGKWEDSTEVLIIKLLAKRYQVNTNDAINYKSILTKNGKLPLVL
KELKGLVTDDFLKEVTKNVKEQKQLKKLALEW
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uk9 Autoinhibition of a clamp-loader ATPase revealed by deep mutagenesis and cryo-EM
Resolution3.1 Å
Binding residue
(original residue number in PDB)		F40 F63 M64 R107 G109 K110 W111
Binding residue
(residue number reindexed from 1)		F39 F62 M63 R106 G108 K109 W110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003689 DNA clamp loader activity
Biological Process
GO:0006260 DNA replication
GO:0039686 bidirectional double-stranded viral DNA replication
GO:0039693 viral DNA genome replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8uk9, PDBe:8uk9, PDBj:8uk9
PDBsum8uk9
PubMed38177685
UniProtP04527|LOADS_BPT4 Sliding-clamp-loader small subunit (Gene Name=62)

[Back to BioLiP]