Structure of PDB 8uk5 Chain A Binding Site BS01

Receptor Information
>8uk5 Chain A (length=132) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIK
EPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRH
RACTLKDTAHAIIAAELDPEFNKLCEEIKEAR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uk5 Impact of Combinatorial Histone Modifications on Acetyllysine Recognition by the ATAD2 and ATAD2B Bromodomains.
Resolution1.4 Å
Binding residue
(original residue number in PDB)
V987 D994 E1036 Y1037 P1039
Binding residue
(residue number reindexed from 1)
V37 D44 E86 Y87 P89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8uk5, PDBe:8uk5, PDBj:8uk5
PDBsum8uk5
PubMed38733345
UniProtQ9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B (Gene Name=ATAD2B)

[Back to BioLiP]