Structure of PDB 8uhl Chain A Binding Site BS01

Receptor Information
>8uhl Chain A (length=135) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLEDQEENTLRELRLFLRDVTKRLATDKRFNIFSKPVDIEEVSDYLEVIK
EPMDLSTVITKIDKHNYLTAKDFLKDIDLICSNALEYNPDKDPGDKIIRH
RACTLKDTAHAIIAAELDPEFNKLCEEIKEARIKR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8uhl Impact of Combinatorial Histone Modifications on Acetyllysine Recognition by the ATAD2 and ATAD2B Bromodomains.
Resolution1.92 Å
Binding residue
(original residue number in PDB)
V987 S993 D994 L1035 E1036 Y1037 N1038 P1039
Binding residue
(residue number reindexed from 1)
V37 S43 D44 L85 E86 Y87 N88 P89
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8uhl, PDBe:8uhl, PDBj:8uhl
PDBsum8uhl
PubMed38733345
UniProtQ9ULI0|ATD2B_HUMAN ATPase family AAA domain-containing protein 2B (Gene Name=ATAD2B)

[Back to BioLiP]