Structure of PDB 8u1z Chain A Binding Site BS01

Receptor Information
>8u1z Chain A (length=125) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDD
IRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQT
EPQNNQAKELERLIDKAMKKDGLVG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8u1z Novel Fis1 inhibiting peptide reverses microvascular endothelial dysfunction in vessels from humans with type 2 diabetes
Resolution1.85 Å
Binding residue
(original residue number in PDB)		E2 V4 L8 R44 K46 N48 I51 V79 Y82 R83 Q106 E109
Binding residue
(residue number reindexed from 1)		E2 V4 L8 R44 K46 N48 I51 V79 Y82 R83 Q106 E109
External links
PDB RCSB:8u1z, PDBe:8u1z, PDBj:8u1z
PDBsum8u1z
PubMed
UniProtQ9Y3D6|FIS1_HUMAN Mitochondrial fission 1 protein (Gene Name=FIS1)

[Back to BioLiP]