Structure of PDB 8tws Chain A Binding Site BS01

Receptor Information
>8tws Chain A (length=294) Species: 317 (Pseudomonas syringae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RALPGPSQRQLEVYDQCLIGAARWPDDSSKSNTPENRAYCQSMYNSIRSA
GDEISRGGITSFEELWGRATEWRLSKLQRGEPLYSAFASERTSDTDAVTP
LVKPYKSVLARVVDHEDAHDEIMQDNLFGDLNVKVYRQTAYLHGNVIPLN
TFRVATDTEYLRDRVAHLRTELGAKALKQHLQRYNPDRIDHTNASYLPII
KDHLNDLYRQAISSDLSQAELISLIARTHWWAASAMPDQRGSAAKAEFAA
RAIASAHGIELPPFRNGNVSDIEAMLSGEEEFVEKYRSLLDSDC
Ligand information
>8tws Chain B (length=25) Species: 3702 (Arabidopsis thaliana) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
APKFGDWDENNPSSADGYTHIFNKV
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tws Pseudomonas effector AvrB is a glycosyltransferase that rhamnosylates plant guardee protein RIN4.
Resolution2.85 Å
Binding residue
(original residue number in PDB)		S119 D120 T121 D122 A123 V124 T125 P126 V128 Y131 V139 T184 L187 R188 R195 A200 K204 Q208 R209 N211 P212 D213 N219 M262
Binding residue
(residue number reindexed from 1)		S93 D94 T95 D96 A97 V98 T99 P100 V102 Y105 V113 T158 L161 R162 R169 A174 K178 Q182 R183 N185 P186 D187 N193 M236
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Cellular Component
GO:0005576 extracellular region

View graph for
Cellular Component
External links
PDB RCSB:8tws, PDBe:8tws, PDBj:8tws
PDBsum8tws
PubMed38354245
UniProtP13835|AVRB_PSESG Avirulence protein B (Gene Name=avrB)

[Back to BioLiP]