Structure of PDB 8twe Chain A Binding Site BS01

Receptor Information
>8twe Chain A (length=387) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDT
IYDEDEVLLALAEQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKA
VESLRAISHEHSPSDLEAHFVPLVKRLAGGDWFTSRTSACGLFSVCYPRV
SSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPM
FSNLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWR
VRYMVADKFTELQKAVGPEITKTDLVPAFQNLMKDCEAEVRAAASHKVKE
FCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIMGLSPILGK
DNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8twe Real-space refinement in PHENIX for cryo-EM and crystallography.
Resolution2.55 Å
Binding residue
(original residue number in PDB)		W257 R258 M262 H340
Binding residue
(residue number reindexed from 1)		W249 R250 M254 H332
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004722 protein serine/threonine phosphatase activity
GO:0005515 protein binding
GO:0019888 protein phosphatase regulator activity
GO:0046982 protein heterodimerization activity
GO:1990405 protein antigen binding
Biological Process
GO:0007059 chromosome segregation
GO:0007143 female meiotic nuclear division
GO:0035331 negative regulation of hippo signaling
GO:0035556 intracellular signal transduction
GO:0040008 regulation of growth
GO:0043029 T cell homeostasis
GO:0045595 regulation of cell differentiation
GO:0051232 meiotic spindle elongation
GO:0051306 mitotic sister chromatid separation
GO:0051754 meiotic sister chromatid cohesion, centromeric
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0065003 protein-containing complex assembly
GO:1903538 regulation of meiotic cell cycle process involved in oocyte maturation
GO:2001241 positive regulation of extrinsic apoptotic signaling pathway in absence of ligand
Cellular Component
GO:0000159 protein phosphatase type 2A complex
GO:0000775 chromosome, centromeric region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0016328 lateral plasma membrane
GO:0030425 dendrite
GO:0042995 cell projection
GO:0043005 neuron projection
GO:0043025 neuronal cell body
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0090443 FAR/SIN/STRIPAK complex
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8twe, PDBe:8twe, PDBj:8twe
PDBsum8twe
PubMed38123684
UniProtP30153|2AAA_HUMAN Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform (Gene Name=PPP2R1A)

[Back to BioLiP]