Structure of PDB 8ttl Chain A Binding Site BS01

Receptor Information
>8ttl Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
QSKIGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVS
GDTSPRHLSNVSSTGSIDMVDSPQLATLADEVSASLAKQG
Ligand information
>8ttl Chain E (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GSVQIVYKPVDLSKVTSKCGSLGNIHH
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ttl Structures of AT8 and PHF1 phosphomimetic tau: Insights into the posttranslational modification code of tau aggregation.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		E391 V398 S400
Binding residue
(residue number reindexed from 1)		E41 V48 S50
External links
PDB RCSB:8ttl, PDBe:8ttl, PDBj:8ttl
PDBsum8ttl
PubMed38408247
UniProtP10636|TAU_HUMAN Microtubule-associated protein tau (Gene Name=MAPT)

[Back to BioLiP]