Structure of PDB 8trr Chain A Binding Site BS01

Receptor Information
>8trr Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8trr T cell recognition of citrullinated alpha-enolase peptide presented by HLA-DR4
Resolution2.65 Å
Binding residue
(original residue number in PDB)
Q9 E11 I31 A52 S53 F54 N62 V65 N69 I72 M73
Binding residue
(residue number reindexed from 1)
Q7 E9 I29 A50 S51 F52 N60 V63 N67 I70 M71
External links
PDB RCSB:8trr, PDBe:8trr, PDBj:8trr
PDBsum8trr
PubMed39043656
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]