Structure of PDB 8trl Chain A Binding Site BS01

Receptor Information
>8trl Chain A (length=179) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8trl T cell recognition of citrullinated alpha-enolase peptide presented by HLA-DR4
Resolution2.4 Å
Binding residue
(original residue number in PDB)
Q9 E11 F22 A52 S53 F54 N62 V65 D66 N69 I72
Binding residue
(residue number reindexed from 1)
Q7 E9 F20 A50 S51 F52 N60 V63 D64 N67 I70
External links
PDB RCSB:8trl, PDBe:8trl, PDBj:8trl
PDBsum8trl
PubMed39043656
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]