Structure of PDB 8trg Chain A Binding Site BS01

Receptor Information
>8trg Chain A (length=325) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALG
AGGLPMGRIVEIYGPESSGKTTLTLQVIAAAQREGKTCAFIDAEHALDPI
YARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPK
AEIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVM
FGNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIA
APFKQAEFQILYGEGINFYGELVDLGVKEKLIEKAGAWYSYKGEKIGQGK
ANATAWLKDNPETAKEIEKKVRELL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8trg The LexA-RecA* structure reveals a lock-and-key mechanism for SOS activation
Resolution2.93 Å
Binding residue
(original residue number in PDB)		M164 R169 M197 I199 N213
Binding residue
(residue number reindexed from 1)		M162 R167 M195 I197 N211
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003684 damaged DNA binding
GO:0003697 single-stranded DNA binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008094 ATP-dependent activity, acting on DNA
GO:0016887 ATP hydrolysis activity
GO:0140297 DNA-binding transcription factor binding
GO:0140664 ATP-dependent DNA damage sensor activity
Biological Process
GO:0000725 recombinational repair
GO:0006259 DNA metabolic process
GO:0006281 DNA repair
GO:0006310 DNA recombination
GO:0006974 DNA damage response
GO:0009432 SOS response
GO:0010212 response to ionizing radiation
GO:0019985 translesion synthesis
GO:0035825 homologous recombination
GO:0048870 cell motility
Cellular Component
GO:0005737 cytoplasm
GO:0009355 DNA polymerase V complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8trg, PDBe:8trg, PDBj:8trg
PDBsum8trg
PubMed38755298
UniProtP0A7G6|RECA_ECOLI Protein RecA (Gene Name=recA)

[Back to BioLiP]