Structure of PDB 8tlo Chain A Binding Site BS01

Receptor Information
>8tlo Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SDTCEYCGKVFKNCSNLTVHRRSHTGERPYKCELCNYACAQSSKLTRHMK
THGQVGKDVYKCEICKMPFSVYSTLEKHMKKWHSD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tlo Crystal Structure Analysis of BCL11A in complex with DNA
Resolution2.76 Å
Binding residue
(original residue number in PDB)		K752 N756 Y777 Q781 K784 R787 H788 T791 V811 T814
Binding residue
(residue number reindexed from 1)		K12 N16 Y37 Q41 K44 R47 H48 T51 V71 T74
External links
PDB RCSB:8tlo, PDBe:8tlo, PDBj:8tlo
PDBsum8tlo
PubMed
UniProtQ9H165|BC11A_HUMAN B-cell lymphoma/leukemia 11A (Gene Name=BCL11A)

[Back to BioLiP]