Structure of PDB 8tll Chain A Binding Site BS01

Receptor Information
>8tll Chain A (length=103) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTLPHIIRPVEEVTEEEIRNICSNSREKIYNRSLGSTCHQCRQKTTDTKT
NCRNPDCWGIRGQFCGPCLRNRYGEEVKDALLDPNWHCPPCRGICNCSFC
RQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tll The ICF syndrome protein CDCA7 harbors a unique DNA-binding domain that recognizes a CpG dyad in the context of a non-B DNA.
Resolution2.58 Å
Binding residue
(original residue number in PDB)		T245 S268 R275 T280 R285 Q286 K287 D299 W301 I303
Binding residue
(residue number reindexed from 1)		T2 S25 R32 T37 R42 Q43 K44 D56 W58 I60
External links
PDB RCSB:8tll, PDBe:8tll, PDBj:8tll
PDBsum8tll
PubMed38168392
UniProtQ9D0M2|CDCA7_MOUSE Cell division cycle-associated protein 7 (Gene Name=Cdca7)

[Back to BioLiP]