Structure of PDB 8tlk Chain A Binding Site BS01

Receptor Information
>8tlk Chain A (length=105) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSVTLPHIIRPVEEITEEELENVCSNSREKIYNRSLGSTCHQCRQKTIDT
KTNCRNPDCWGVRGQFCGPCLRNRYGEEVRDALLDPNWHCPPCRGICNCS
FCRQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tlk The ICF syndrome protein CDCA7 harbors a unique DNA-binding domain that recognizes a CpG dyad in the context of a non-B DNA.
Resolution2.99 Å
Binding residue
(original residue number in PDB)		G231 T234 L235 S257 R258 R264 T269 R274 Q275 K276 D288 W290 G291 V292
Binding residue
(residue number reindexed from 1)		G1 T4 L5 S27 R28 R34 T39 R44 Q45 K46 D58 W60 G61 V62
External links
PDB RCSB:8tlk, PDBe:8tlk, PDBj:8tlk
PDBsum8tlk
PubMed38168392
UniProtQ9BWT1|CDCA7_HUMAN Cell division cycle-associated protein 7 (Gene Name=CDCA7)

[Back to BioLiP]