Structure of PDB 8tlg Chain A Binding Site BS01

Receptor Information
>8tlg Chain A (length=103) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTLPHIIRPVEEVTEEEIRNICSNSREKIYNRSLGSTCHQCRQKTTDTKT
NCRNPDCWGIRGQFCGPCLRNRYGEEVKDALLDPNWHCPPCRGICNCSFC
RQR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tlg The ICF syndrome protein CDCA7 harbors a unique DNA-binding domain that recognizes a CpG dyad in the context of a non-B DNA.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		T245 S268 R269 R275 T280 R285 Q286 K287 D299 W301 G302 I303
Binding residue
(residue number reindexed from 1)		T2 S25 R26 R32 T37 R42 Q43 K44 D56 W58 G59 I60
External links
PDB RCSB:8tlg, PDBe:8tlg, PDBj:8tlg
PDBsum8tlg
PubMed38168392
UniProtQ9D0M2|CDCA7_MOUSE Cell division cycle-associated protein 7 (Gene Name=Cdca7)

[Back to BioLiP]