Structure of PDB 8tkl Chain A Binding Site BS01

Receptor Information

>8tkl Chain A (length=312) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GPYLQILEQPKQRGFRFRYVCEGPSHGGLPGASSEKNKKSYPQVKICNYV
GPAKVIVQLVTNGKNIHLHAHSLVGKHCEDGVCTVTAGPKDMVVGFANLG
ILHVTKKKVFETLEARMTEACIRGYNPGLLVHSDLAYLQAEGGGDRQLTD
REKEIIRQAAVQQTKEMDLSVVRLMFTAFLPDSTGSFTRRLEPVVSDAIY
DSKAPNASNLKIVRMDRTAGCVTGGEEIYLLCDKVQKDDIQIRFYEEEEN
GGVWEGFGDFSPTDVHRQFAIVFKTPKYKDVNITKPASVFVQLRRKSDLE
TSEPKPFLYYPE

Ligand information

>8tkl Chain C (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcaggggaattcccctc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8tkl X-ray Crystallographic Study of Preferred Spacing by the NF-kappa B p50 Homodimer on kappa B DNA.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	R54 R56 S63 H64 G65
Binding residue (residue number reindexed from 1)	R16 R18 S25 H26 G27

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8tkl, PDBe:8tkl, PDBj:8tkl
PDBsum	8tkl
PubMed	37759710
UniProt	P25799\|NFKB1_MOUSE Nuclear factor NF-kappa-B p105 subunit (Gene Name=Nfkb1)

[Back to BioLiP]