Structure of PDB 8ti7 Chain A Binding Site BS01

Receptor Information
>8ti7 Chain A (length=132) Species: 6956 (Dermatophagoides pteronyssinus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSGSWQSYVDNQICQHVDCTLAAIANIQDGSIWAKFEKDDKKISPKELKT
IADTIRQNPNGFLETGIHIGGEKYICIQADNQLVRGRRGSSALCIVATNT
CLLAAATVDGYPAGQLNNVIEKLGDYLRSNNY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8ti7 Structural homology of mite profilins to plant profilins is not indicative of allergic cross-reactivity.
Resolution2.397 Å
Binding residue
(original residue number in PDB)		S0 G1 S2 W3 Y6 W31 Y124 L125 Y130
Binding residue
(residue number reindexed from 1)		S2 G3 S4 W5 Y8 W33 Y126 L127 Y132
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003779 actin binding
GO:0003785 actin monomer binding
Biological Process
GO:0042989 sequestering of actin monomers
GO:0044087 regulation of cellular component biogenesis
GO:0051128 regulation of cellular component organization
Cellular Component
GO:0005856 cytoskeleton
GO:0005938 cell cortex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8ti7, PDBe:8ti7, PDBj:8ti7
PDBsum8ti7
PubMed38662449
UniProtA0A2L0EBJ5

[Back to BioLiP]