Structure of PDB 8tg7 Chain A Binding Site BS01

Receptor Information
>8tg7 Chain A (length=66) Species: 2681611 (Escherichia phage Lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DITPVNDETMQEINTLLIALDKTWDDDLLPLCSQIFRRDIRASSELTQAE
AVKALGFLKQKAAEQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tg7 Structural basis for the interaction of Red-beta single strand annealing protein with Escherichia coli single stranded DNA binding protein.
Resolution1.775 Å
Binding residue
(original residue number in PDB)
P222 Q226
Binding residue
(residue number reindexed from 1)
P30 Q34
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:8tg7, PDBe:8tg7, PDBj:8tg7
PDBsum8tg7
PubMed38663547
UniProtP03698|VBET_LAMBD Recombination protein bet (Gene Name=bet)

[Back to BioLiP]