Structure of PDB 8tg4 Chain A Binding Site BS01

Receptor Information
>8tg4 Chain A (length=182) Species: 56636 (Aeropyrum pernix) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HMRVRLSKTLAGILRHHPGRYGVRLTREGWARVSEVVEGLRKAGWSWVEE
WHIVGVALHDPKGRYELRNGEIRARYGHSIPVNVEPLPGEPPPILYHGTT
EEALPLIMERGIMRGRRLKVHLTSSLEDAVSTGRRHGNLVAVLLVDVECL
RRRGLKVERMSKTVYTVDWVPPECIAEVRRES
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tg4 Structural basis for Tpt1-catalyzed 2'-PO 4 transfer from RNA and NADP(H) to NAD.
Resolution1.37 Å
Binding residue
(original residue number in PDB)		V3 S6 K7 G11 R14 H15 H16 R63 R115 R116
Binding residue
(residue number reindexed from 1)		V4 S7 K8 G12 R15 H16 H17 R64 R116 R117
Enzymatic activity
Enzyme Commision number 2.7.1.-
Gene Ontology
Molecular Function
GO:0003950 NAD+-protein poly-ADP-ribosyltransferase activity
GO:0016740 transferase activity

View graph for
Molecular Function
External links
PDB RCSB:8tg4, PDBe:8tg4, PDBj:8tg4
PDBsum8tg4
PubMed37883434
UniProtQ9YFP5|KPTA_AERPE Probable RNA 2'-phosphotransferase (Gene Name=kptA)

[Back to BioLiP]