Structure of PDB 8tbp Chain A Binding Site BS01

Receptor Information
>8tbp Chain A (length=178) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFAS
FEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREPN
VLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLPF
LPSTEDVYDCRVEHWGLDEPLLKHWEFD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8tbp Smith-specific regulatory T cells halt the progression of lupus nephritis.
Resolution3.12621 Å
Binding residue
(original residue number in PDB)		Q9 F51 A52 S53 F54 G58 N62 N69 I72 M73 R76
Binding residue
(residue number reindexed from 1)		Q6 F48 A49 S50 F51 G55 N59 N66 I69 M70 R73
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8tbp, PDBe:8tbp, PDBj:8tbp
PDBsum8tbp
PubMed38321013
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]