Structure of PDB 8t9f Chain A Binding Site BS01

Receptor Information
>8t9f Chain A (length=96) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAV
MALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Ligand information
>8t9f Chain I (length=122) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
tcgagaatcccggtgccgaggccgctcaattggtcgtagacagctctagc
accgcttaaacgcacgtacggattctcccccgcgttttaaccgccaaggg
gattactccctagtctccaggc
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t9f Catalytic and non-catalytic mechanisms of histone H4 lysine 20 methyltransferase SUV420H1.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		R40 R72 F84 R116 V117 T118
Binding residue
(residue number reindexed from 1)		R1 R33 F45 R77 V78 T79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0046982 protein heterodimerization activity
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:8t9f, PDBe:8t9f, PDBj:8t9f
PDBsum8t9f
PubMed37595555
UniProtP84233|H32_XENLA Histone H3.2

[Back to BioLiP]