Structure of PDB 8t8g Chain A Binding Site BS01

Receptor Information
>8t8g Chain A (length=157) Species: 1314 (Streptococcus pyogenes) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LPVIGGIAIPELGINLPIFKGLGNTELIYGAGTMKEEQVMGGENNYSLAS
HHIFGITGSSQMLFSPLERAQNGMSIYLTDKEKIYEYIIKDVFTVAPERV
DVIDDTAGLKEVTLVTATDIEATERIIVKGELKTEYDFDKAPADVLKAFN
HSYNQVS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t8g A unique binding mode of P1' Leu-containing target sequences for Streptococcus pyogenes sortase A results in alternative cleavage.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		H142 H143 P188 V206 A208 R216
Binding residue
(residue number reindexed from 1)		H51 H52 P97 V115 A117 R125
Enzymatic activity
Enzyme Commision number ?
External links