Structure of PDB 8t65 Chain A Binding Site BS01

Receptor Information
>8t65 Chain A (length=155) Species: 472759 (Nitrosococcus halophilus Nc 4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NRFPRVGGVSESTVQWEGVVFTVSNESVPRWVMAQIQPAYMGLVATQASL
AAAEAVAAVARRRGIEVHGPLQVADPNDPAASRSQVALLLSELRRAGCRE
IAVDLTGGKLPMSLGAFMAAEEAGVASLYVATDFDKHLKVPDMRTATLRQ
ISQPE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t65 The CRISPR effector Cam1 mediates membrane depolarization for phage defence.
Resolution2.09 Å
Binding residue
(original residue number in PDB)		S75 V79 T97 T157 G159 K160 L161 Y180 F185 L189 P192
Binding residue
(residue number reindexed from 1)		S24 V28 T46 T106 G108 K109 L110 Y129 F134 L138 P141
Enzymatic activity
Enzyme Commision number ?
External links