Structure of PDB 8t5q Chain A Binding Site BS01

Receptor Information
>8t5q Chain A (length=168) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYT
SRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLM
LLDQNNREHVIDAFRPDVTSSSFQRPVNDMNIASGCPLFCPVSKMEAKNS
YVRDDAIFIKAIVDLTGL
Ligand information
>8t5q Chain G (length=5) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PIQAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t5q SARS-CoV-2 ORF3a-Mediated NF-kappa B Activation Is Not Dependent on TRAF-Binding Sequence
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D399 F410 F447 S455 I465 A466 S467 G468 P470
Binding residue
(residue number reindexed from 1)		D66 F77 F114 S122 I132 A133 S134 G135 P137
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0007250 activation of NF-kappaB-inducing kinase activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0042981 regulation of apoptotic process
GO:0046328 regulation of JNK cascade
GO:0051865 protein autoubiquitination

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8t5q, PDBe:8t5q, PDBj:8t5q
PDBsum8t5q
PubMed38005906
UniProtQ12933|TRAF2_HUMAN TNF receptor-associated factor 2 (Gene Name=TRAF2)

[Back to BioLiP]