Structure of PDB 8t5p Chain A Binding Site BS01

Receptor Information
>8t5p Chain A (length=190) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKR
RKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVI
MRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGDAFKPDPNSSSFKKPTGE
MNIASGCPVFVAQTVLENGTYIKDDTIFIKVIVDTSDLPD
Ligand information
>8t5p Chain G (length=5) Species: 2697049 (Severe acute respiratory syndrome coronavirus 2) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PIQAS
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t5p SARS-CoV-2 ORF3a-Mediated NF-kappa B Activation Is Not Dependent on TRAF-Binding Sequence
Resolution2.5 Å
Binding residue
(original residue number in PDB)		D462 I529 A530 S531 G532 P534
Binding residue
(residue number reindexed from 1)		D86 I153 A154 S155 G156 P158
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
Gene Ontology
Molecular Function
GO:0005164 tumor necrosis factor receptor binding
Biological Process
GO:0001817 regulation of cytokine production
GO:0008063 Toll signaling pathway
GO:0032088 negative regulation of NF-kappaB transcription factor activity
GO:0033209 tumor necrosis factor-mediated signaling pathway
GO:0045087 innate immune response
GO:0050688 regulation of defense response to virus

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8t5p, PDBe:8t5p, PDBj:8t5p
PDBsum8t5p
PubMed38005906
UniProtQ13114|TRAF3_HUMAN TNF receptor-associated factor 3 (Gene Name=TRAF3)

[Back to BioLiP]