Structure of PDB 8t59 Chain A Binding Site BS01

Receptor Information
>8t59 Chain A (length=210) Species: 32630 (synthetic construct) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLKLSCATSGFPFSNVWLHWVRQASGKGPEWVAH
IKAKSDNYATYYAESVKGRFTISRDDSKNTVYLQMNSLKTEDTAVYYCTD
ILEYWGQGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTV
SWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKP
SNTKVDKKVE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t59 Rapid affinity optimization of an anti-TREM2 clinical lead antibody by cross-lineage immune repertoire mining
Resolution2.0 Å
Binding residue
(original residue number in PDB)		F27 P28 V32 W33 D100 L102 E103 Y104
Binding residue
(residue number reindexed from 1)		F27 P28 V32 W33 D100 L102 E103 Y104
External links