Structure of PDB 8t51 Chain A Binding Site BS01

Receptor Information
>8t51 Chain A (length=215) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVQLVESGGGLVQPGGSLKLSCATSGFPFSNVWMHWVRQASGKGLEWIAH
IKAKSDNYATYYAESVKGRFTISRDDSKTTIYLQMNSLKTEDTAVYYCTG
LDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEP
VTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVN
HKPSNTKVDKKVEPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8t51 Rapid affinity optimization of an anti-TREM2 clinical lead antibody by cross-lineage immune repertoire mining
Resolution1.9 Å
Binding residue
(original residue number in PDB)		V2 F27 P28 N31 V32 W33 D102 Y103
Binding residue
(residue number reindexed from 1)		V2 F27 P28 N31 V32 W33 D102 Y103
External links