Structure of PDB 8t4r Chain A Binding Site BS01

Receptor Information

>8t4r Chain A (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SGYWITCCPTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLA
ERTLIHLSAGSNKYYCNEHVEIARA

Ligand information

>8t4r Chain D (length=9) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

ARTKQTARK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8t4r Trimethyllysine Reader Proteins Exhibit Widespread Charge-Agnostic Binding via Different Mechanisms to Cationic and Neutral Ligands.
Resolution	1.2 Å
Binding residue (original residue number in PDB)	G414 Y415 T436 A442 M443 I444 Y445 W453 L469 S470 G472 N474
Binding residue (residue number reindexed from 1)	G2 Y3 T24 A30 M31 I32 Y33 W41 L57 S58 G60 N62

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding

	Biological Process
GO:0006310	DNA recombination

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8t4r, PDBe:8t4r, PDBj:8t4r
PDBsum	8t4r
PubMed	38266163
UniProt	P55895\|RAG2_HUMAN V(D)J recombination-activating protein 2 (Gene Name=RAG2)

[Back to BioLiP]