Structure of PDB 8t2u Chain A Binding Site BS01

Receptor Information

>8t2u Chain A (length=448) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

PVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVF
LCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVI
VACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRI
YVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIF
SSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYV
VGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRH
DLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYG
RFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPS
QVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQP

Ligand information

>8t2u Chain C (length=7) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

CRGDWPC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	8t2u Cryo-EM structures of full-length integrin alpha IIb beta 3 in native lipids.
Resolution	3.1 Å
Binding residue (original residue number in PDB)	Y189 Y190 L192 S225 F231
Binding residue (residue number reindexed from 1)	Y185 Y186 L188 S221 F227

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0005178	integrin binding
GO:0005515	protein binding
GO:0042802	identical protein binding
GO:0046872	metal ion binding
GO:0050840	extracellular matrix binding
GO:0060090	molecular adaptor activity
GO:0070051	fibrinogen binding

	Biological Process
GO:0001525	angiogenesis
GO:0002687	positive regulation of leukocyte migration
GO:0007155	cell adhesion
GO:0007160	cell-matrix adhesion
GO:0007229	integrin-mediated signaling pathway
GO:0033627	cell adhesion mediated by integrin
GO:0098609	cell-cell adhesion

	Cellular Component
GO:0005886	plasma membrane
GO:0005925	focal adhesion
GO:0008305	integrin complex
GO:0009897	external side of plasma membrane
GO:0009986	cell surface
GO:0016020	membrane
GO:0031092	platelet alpha granule membrane
GO:0070062	extracellular exosome
GO:0070442	integrin alphaIIb-beta3 complex
GO:0072562	blood microparticle

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8t2u, PDBe:8t2u, PDBj:8t2u
PDBsum	8t2u
PubMed	37443315
UniProt	P08514\|ITA2B_HUMAN Integrin alpha-IIb (Gene Name=ITGA2B)

[Back to BioLiP]