Structure of PDB 8swc Chain A Binding Site BS01

Receptor Information
>8swc Chain A (length=149) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DFVVVYTDGCCSSNGRRRPRAGIGVYWGPGHPLNVGIRLPGRQTNQRAEI
HAACKAIEQAKTQNINKLVLYTNSMFTINGITNWVQGWKKNGWKTSAGKE
VINKEDFVALERLTQGMDIQWMHVPGHSGFIGNEEADRLAREGAKQSED
Ligand information
>8swc Chain B (length=20) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
uggcgagugggugagugagg
....................
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB8swc Crystal structure of RNase H/RNA/PO-ASO complex at an atomic level
Resolution2.68 Å
Binding residue
(original residue number in PDB)		C147 C148 S150 N151 R153 N182 E186 N210 M212 H260 P262 G263 R278
Binding residue
(residue number reindexed from 1)		C10 C11 S13 N14 R16 N45 E49 N73 M75 H123 P125 G126 R141
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0004519 endonuclease activity
GO:0004523 RNA-DNA hybrid ribonuclease activity
GO:0004540 RNA nuclease activity
GO:0005515 protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006401 RNA catabolic process
GO:0043137 DNA replication, removal of RNA primer
Cellular Component
GO:0005737 cytoplasm
GO:0005739 mitochondrion

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8swc, PDBe:8swc, PDBj:8swc
PDBsum8swc
PubMed
UniProtO60930|RNH1_HUMAN Ribonuclease H1 (Gene Name=RNASEH1)

[Back to BioLiP]